The Daily Alaska empire Newspaper, September 22, 1941, Page 5

Page views left: 0

You have reached the hourly page view limit. Unlock higher limit to our entire archive!

Subscribers enjoy higher page view limit, downloads, and exclusive features.

Text content (automatically generated)

. THE DAILY ALASKA EMPIRE, MONDAY, SEPT.:22, 1941. @&arredfi fer FALL | RETAILERS DRAMATIZING LEADERSHIP For the past three years organ- ized retailers have staged during a week each September, what has come to be Lnown as National Re- | tajl Demonscration, set apart for| the dramatizing, to the pudlic at ‘arge the :mportant role played | by the . million, elght hundred| thousand retailers in the social and economic lif¢ of the nation. This year the theme is “Ruiailers| for Defense.” Price Trend | executive set-up for campaign is unusual and | “Major Benjammn H.| | president of the Namm l"torr‘. in .Brwoklyn, N. Y. is Na- \tional Chalrman, and Donald M Nelson. Di-ector of Purchases, Of-} tion Managem-nt, is Honorarv_Clairman, In aceentine this post. Mr. Nelson ‘aclated that the retail trade of the | *™mited "Statse has set a nlendid xamnle to =11 business in its efforts tn prévent unjustifiable price ad-| addmn that “in this thev| The this | | | vear” |?mpmng. | Namm, annes tion.” | The d'9sratisns reculting from f o1t ” with drereasing intensity, be H[ “@-inwasiand retailers have, through I! netrintie.Jea/ership. helped fo cush- | | | | | | i | | | | |'*n what mieht otaerwise be a per- icd of. considerable danger to busi- neec a5 a whele. | The . Honorarv Chairman also feels that retailers are playing an immeasurably . important 1ole in combating unjustified- price advan- ces, and thereby preventing. what might easily develop into a runaway - price trend. ! Amcng the faciors that can con-| Heatherstone Covert, an excitingly new fabric slated to go places this Fall! - Featured he mooth 3-piece long jacket suit with box top- ctst: The SkInce Junicr, phetegravhed rieht has new smoother shoulders, convertible collar, and stunning belted back. Photo courtesy Fierman and Kolmer, New York. 2.Piece Fur Ensembles e s i i i, SRbEhpract tribute very <definitely to th. De- cal trio—at a bud- fense Program, and to tha least nossible interfsrence with civilian get price. Stunning 32" oat, big soft matching nuff, hat Wear it fashionably every- re through Winter wear the muff and requirements, i that of the Na- tional Retail Dry Goods Associa- tion’s campaign to bring abcut | “implification of merchandise lines| et standardization). [ With &impler lines there can ke more production, without recourse ! te “curteilment” as such, and this merchandise situation. In speakine about the realistic role the retailer must play in the| nresenit emergency, Major Renfa-| min H. Namm, National Chair- n | FURS { P iman of “Retailers for Defense” | ° |said that “it would be folly, indeed, 0" Qu“"ty if under the stres; of wartim: emo-| n tion, we failed to realize tlat the ' greatet servide that we can render | to our country s to concentrate| iuppn doing the-job for which we/ are best fitted—retall distribution— ‘and doing" that . job more. effectively | than it has ever been done hefore.” HOSIERY HURRAHS Three ¢heers for the new hcsiéry! {1t 1s following ‘the colofs - coura- knit' gcously, @nd doing its bit ‘to turn a'out the New Woman peérfectly ac- ! cessorized. Hoslery colors dre keyed to cos- tume colors. or_shoe leather colors, | are guaranteed moth-proof. {so that from hemline to heel there's — e ian unbroken line. -Very-slimming, | ka Emp.c aas the and very flattering in. blue, green, Al- wine, taupe or brown—all 'of them dark and no’ a.bit daring. ! YOUR ORDER. ! hat with other ‘cos- tumes . a bi movement will prove of inestimable ‘ ““y““ .. One'of a blg | help in solving the new problems of | ] collection MADE .TO the small store in the present light/| { Yurman Fur Faclory = e »“ NEW KNIT STYLES The shapcless, close-fitting garments of years ago is now legend. Knit fabrics have been constantly 1mproved so that they, will not sag or stretch. And they CAMPUS CUTOUT _answer to a college man's prayer for something new—and dashing—in clothes is this outfit: hat of rough finish blue mixture felt, side-dented: blue and white checked sports coat worn over a double breasted knitted waistcoat. The Daily Alasl largest, paid circulation of any aska newspaper. A New Fall Figure SIGR_I D’°S . The Beauty Workshop Can make you an EXCITING apd ATTRACTIVE Woman { | N6 doubt you are still wondering about.those DEWAR SYSTEM treatments which we have been proclaiming for some nme You ;e.m_ember—thm new and startling way to reduce—— S g it : without massage without exercise . . without d!stfom!ofl without diet without drugs without heat and vyet, in the utmost safetyl Well, it would take a long; long time to de- paratus which makes all of this possible. scribe the marvelous ap) SOFT and LUXURIOUS we recommend... ZOTOX the ultimate permanent In other words, you get all We can tell you this it is PASSIVE EXERCISE. . So, of course, you won't of the benelfils of active exércise without lifting a finger! even get tired! . Stop in and let us explain the beauties of the DEWAR SYSTEM a little more fully. w Let our experts style you hair to suit your personality. 3 9 [} S.gr‘d s Beauty Sal"" One Parker-Herbex treatment : 3 COOPER BUILDING free of charge after every new permanent. Mrs. Yvonne Cooper PHONE 318 FURS FOR . EVERYONE PROVIDED | books-Various Groups in 1942 Silhouettes yiced for every " pockstbook-=from dyed coney, a sleek, smart, inex- pensive budget fur to magnificent ! mink. . the aristocrat of the fur kingdom Most. important, these budeet fur eants ars styled in the same fitted “nd swazger silhcuettes and fcature the same smooth shoulders, wide | bell, bishop or shirt-sleeve cuffs as |the expensive fur coats. Of ths group known as budget {furs, sable — and mink-blended ymuskrat are headliners in nopular- {ity, ' comhining the fashion-impor- | tant brewn shades with expensive- {Jook Mg skins. | Also p-pular are the sturdy, cas- ynal Jong-hajred furs — raccoon, | ~pessum, squirrel, skunk, and sil- |vered fox. Persian paw, sealine, ceal and sable-dyed coney too are | volume sellers in this group | Fur jackets are modest in price, | worderfully wearable with suits as |well as for formal ‘evening wear. IMink and sable-blended wmuckrat, guanceo, opossum, cross-dyed fox, red and silvered fox are among the fashion-important furs priced well with modest budgets, | | 3-Piece Fur Ensemble Fayoril with college gir: smart young woemen everyw the 3-piece fur emsembles c: ing of jackets or 32" coats, match- ing mufis and hats. - Excention- ally smart for both dressy and spertswaar, fur. ensembles arc wear- able ' throughout Winter. Jacket styles range from the per- enial favorite boxy jacket with its high reund neck fastening to 1942's newest facket. silhouettes, the tux- edo-front style and jacket with the johnny collar. The 32” coais are Y_zenemlly boxy or straight swagger models with - collarless - necklines, johnny collars, small- or notched revers, PR P s ) - GLOVE GAMBOL ! Gloves are in a playful mood for |the Fall season. They are color- | donisEicus to the nth degree, in a|i¢ many’ Juseau resdents will;arise’ « Profile brims are on the dash= wite range of costume colors, rang-|to - offiefally . greet - the start..of ing) slde for " early "Fall. “They ate ing ‘from taupe through brown, and Including dep "greens, ‘reds, blues and .wines. 2 There . are - gloyes that can be converted “into mittens, - by - pulling | up a cowl cuff that | the ‘tingers. | And there are.fabric .gloves.that troll ‘up and down lKe a .Venetian | blind’ to any desired Iength, by means of cleverly manipulated ! drawstrings, | - | Summer gardening is likely to | play ‘havoc with the hands, leav- g them rough and hard to keep clean. Here is ‘a remedy, easy. to make and inexpensive: mix in =& jar or” bottle a cup of strained lemon each’ of rubbing alcohol and glycerine. Keep covered and ap- ply as needed. puckers up over BUY DEFENSE STAMPS Coais Priced fo Fix Pocke!- | | Owniny a fur ceat is no Jonger 1 xury to be afforded ou'y by the few. Today there are fur coats | juice and one-fourth cup! $LBEE k1 ¥ >y v € 1 Novel buttons of original design frocks which lovely ladies will wear to luncheons One lady smartly’ en- and parties this Fall. sembles her hat to her costume with a pin-clp which matches her buttons. Like hand-wrought . silver pins, these’ metal dress up these by trimming it N v 5 5 H B. G. E. Originales buttons and companion olip dramatize a stag motif outlined against circlet. Brass wire looped into a bowknot adds | disincton to the long torso dark crepe dress. Both bottoms are B. G. E. Originales. 4 FALL OFFICIALLY BEGINS TUESDAY AT 2:33 IN MORN New Styles, Talk of.Foof- ball Are All Harbing- ers of Autumn | showers predicted, 1t is doubtful | Autumn_season, at 2:33 a. m.to- MOITOW. ughered: in- by ‘local “celebration or not, it is scheduled to start at that ime, = according : to the 'Weather Bureau office here. ! Local ' merchants have alieady hailed the, fall season, with displays | of ‘autumn styles in their shopiwin- ,dows and seasonal decorations’ of the “colored ‘leaves which are har- bingers of fall. In the newspapers, that unfailing sign of fall apvears as stories ‘of football Scneduss w1 the States and predictions of ex- perts about which teams will win the major college conferenc: crowd the sports pages. Meantime, fall weather has al- | ready praceded the official opening of the season by several days, -Dur- ing the 48-hour period ending at {4:30 a. m. today, a total of 5.714 |inches of rain fell at Ketchikan while 202 inches fell at Juneau. , stitehed sleeve cuffs, and | These are typicalisuit and topcoat fashions wwlnmytweedvllhshmmrphflhlnnwhd for Fall. Left: The button: its slightly shorter length is new. ¢ lapels, Right;, The deuble-breasted business suit in striped worsted holds top positon, for business aml formal campus wear, | With cloudy weather, and . slight | But . whether -the fall season is'tume. Weather reports showed heavy rain- | falls exceeding 2 inches, in most of | Southeastern Alaska during the| past two days. That. fall - weather will continue | for several days before ther> is any | let-up was further indicated by the prediction of three or four days of cloudy and rainy weather. > KNITTED ' SWEATERS Knitted sweaters adopt the new V-necks ' with applauded results.| Their clor- range takes in Fall's| rich cocoa prowns to lovely pastels, ARREE M i PROFILE BRIMS full{ of verve, with a spirited lift that' will vitalize 'the simplest cos- Highlights 0t Handbags Handbags for Fall are ih Ll'" grand manner. Suedes In soo'z black, or costume colors—includis wine and green, favor massive,orii- aments of eatyed crystal” with priceless look. “Muff bags, in suede, coating “fabrics,” or ‘fuf ‘trims,, are | bigger and more pillowy than evc‘. y- 1100k ¢ with a ~lap ~robe luxi 2 price’ g will raisé the ‘mental’ any. costume. e — 1] To, relieve the mmplfie, :ol fuel, i *Subscribe for The Empire. the peat production in Sweden You'll buy your first less will do — either for . .. Hear-Say is interesting but Wear-Say is convincing! cithet on cur word, ot somebody else’s. But you'll ‘come back for a second, strictly on the basis of servica rendered! And because the “repeat” purchase is vitally ' important to a reputable maker — TIMELY CLOTHES ! take care to back up fine appearance with enduring fabrics, enduring needlecraft and enduring fit. Nothing wi seach about 500,000 tons this yé-rz suit of TIMELY CLOTHES you o Timely!

Other pages from this issue: