Bemidji Daily Pioneer Newspaper, September 2, 1915, Page 2

. Qne:month: by carrier. - BRANCHES:IN. ALL-THE PRINCIPAL CITIES L RS ““was Teader in financial circles. _ Dberately all yesterday in effort to ““issuéd by Robert H. Dowman, presi’ dent of the National Lumber Manu-[" ~ “Ahout a year ago I used two bot- opd-class matter under Act { March 3, 1879. s tp the editor, but not nacenu-fly 0% @ublication. inicationa for the: Weekly: Plo- ould reach this office not later than' Puesday of .each week to insure publication in the ocurrent issue. © subscription Rates. One year by.carriar.. ‘Three .maontha,’ M'&I‘ paid 8ix months, postage paid One yur. Rostage paid..... : 'The:{Weekly : Ploneer. !:llht Pages, containing a summary of the news -of- the week.-- Publighed every THursday and ‘dent postage paid to any address for $1.50 in advance. T o Ty e e tHIS PAPER'REPRESENTED FOR FOREIGN 1 o ADVERTISING BY THE SSDEIATIDN o:u!mil. ol NEW YORK: AN! FICES CHICAGO —_— ’i’ililii’iiil*i’ * Th Dafly Ploneer recelves & ¥ wire service of the United % . %% Press ‘Association. * * : ‘ * KKK KK KKK KKK KK KE WILSON' SCORES - VICTORY. Germnny, by her action yesterday in decepting the demands of the United States in regard to submarine warfare, has dignified this nation as a world force. - The official test of the German ac- ceptance presented to Secretary of State Lansing by Johann von Bern- storff,» German ambassador, yester- day is as follows: “My Dear :Secretary: ““With: reference to our. conversa- tion of this morning, I beg to inform you.that my-instructions concerning our answer to your: last Lusitania ngte contains the following passage: “Liners will not be sunk by our sub- marines without warning and with- out. safety of the lives of non-com- batants, provided that the liners do not try to escape or offer = resist- ance! ‘“Although I know you do not wish to discuss the Lusitania question till the Arabic incident has been definite- 1y and satisfactorily settled, I desire to inform you of the above because this policy of my government was decided before the Arabic incident occurred. *‘ have no objection to your making any use you may please of the above information. ‘ remain, my dear Mr. Lansing, ““Very sincerely yours, (Signed) ‘J. BERNSTORFF.” In connection with the letter Sec- retary Lansing made the following statement: “In view of the clearness of the foregoing statement, it seems need- less to make any comment in regard to it, other than to say that it ap- pears to be a return to the funda-] mental principle for which we have contended.” What the government has gained by the recognition of the principle contended for, that submarines could carry on war only according to the rules of international law as it stood when this present war began. For a long time Germany has contended that the conditions of war have vir- tually changed the rules. The Unit- ed States stuck to the point that the law was law and could not be changed by a belligerent. President Wilson and Secretary Lansing today feel themselves fully Jjustified in ' their refusal to- follow the lead of Bryan and ‘Roosevelt and they have a perfect right to. -By ‘patience and ‘skill' and frank- ness President ‘Wilson has made Ger- many concede to all that she would have to concede to after a war. ———e LR R R R S e * BOILED NEWS. TR K KK KA XK KKK ‘—Marquis Kaoru Inouye, one of the elder statésmen of Japan, died yes- terday at Tokyo, aged 80 years. ‘He —More than 250 men worked des- curb’ forest fires at_Mount Hood, 80 miles southéast of Portland, Ore. The fire has a ten-mile front and cai not be broken. unless. _rain . com soon. —A call for a conference of lumbet=| men at Chicago, Sept. 15, has been facturers’ ‘association.” Plans will be former for general ‘co-operation ;in rates and’ classification for informa- tion to be presented to the interstate commerce commission. A" dispntch rrom Rome via Paris says’ ‘that “Pope ‘Benediet’s anxiety over the war has reached such a ‘point that he is restless and suffering from insom a. Biliousness and Constipation. . It is certainly snrprising that any ‘woman will endure the miser_nble feelings caused by biliousness and onstipation, when relief is so easily had and at so. little expense. Mrs. Chas. Peck, Gates, N. Y., . writes: tles' of Chamberlain’s Tablets and they ‘cured me of biliousness llld constipation.” Obtainable every where.—Adv. mining companies. trade. wheat and Winnipeg October strong, parent. bought by the Canadian government POWERS URGES :PREUS T0 ‘SIEZE:MINE LANDS Hibbing, Minn., Sept. Victor ‘L. Power today ' mailed State Auditor Preus a long letter de- claring that the United States Steel corporation and other mining com- panies holding iron ore lands leased from the state within the village limits of Hibbing have, by reason of the fact that they have failed td pay the taxes assessed against such leases, forfeited their right to such leases, and that the state has the right under the terms of its mining leases to seize such lands and by such: act cancel the leases thereon. Must Cancel Lease. Mr. Power calls upon the state au- ditor to cancel these leases at once and thus restore to the state prop- erty, which, he declares, is worth $100,000,000. The specific. proper- ties cited by Mayor Power are the Philbin mine and the Burt-Poole pit operated by the Steel corporation; the Scranton mine, operated by the Pick- ands-Mather company, and the Niag- ara property, controlled by the Great Northern, but not yet .opened up. Mr. Power says that he has not 2.—Mayor to searched the records and that there may be still other state properties within the village limits leased to Mr. Power calls attention to the provision of the state’s leases, which says that the lessees shall pay all taxes against the land, “or the iron ore products there- of,” or any improvements thereon. 279,544,404 ACRES OF PUBLIC LAND LEFT ‘Washington, Sept. 2.—More than 11,200,000 acres of land were elim- inated from the public domain dur- ing the past fiscal year by homestead and other entries and sold to in- dividuals, the annual report of Com- missioner Tallman of the general land office will show. There are still, however, 279,544,404 acres, “unappropriated and unreserved, of which 172,987,912 acres are survey- ed and the rest unreserved.” All this is in the 25 public land states. The total of all public lands re-; maining in northwestern states em- braces: Idaho, 16,212,273 acres; Michigan, 76,030; Minnesota, 943,- 831; Montana, 19,065,121; Nebraska 192,358; Oregon, 15,442,178; Utah, 33,363,837; Washington, 1,144,605; Wisconsin, 6,758; Wyoming, 30, 929,969. Western Canada Makes Excuses. Winnipeg, Man., Sept. 2.—That Western Canada will not have the enormous crop previously predicted was made known today, following the recent heavy frosts. The crop will hardly go 250,000,000. Ten de- grees was recorded at Swan River, Man., during the recent cold snap. In Northern Manitoba and Northern Saskatchewan wheat was not vested and was affected: In southern parts of these provinces grain was not affected. Reports that the government in- tended to take over all this year’s crop at a set price have not affected | Liverpool is higher for spot is with exporters buying ap- of One million busheéls wheat .In-f'ants ::; Invalids . HORLICK'S THE-ORIGINAL MALTED MILK The Food-Drink for all Ages Rick' milk, malted grain, in powder form. Forinfants, invalids asd growing children. Pure nutrition; upbulldmflhwhole body: Invigoretes nursingmothers and the aged. More healthful than tea or coff:e. Usiess:you say. | K'S™* ‘HORLIO! . you may get a substitute. 'mi"m Gold melilic Tm. saled ue_Ribbo Ask for Cll IIEB- > n"i o el fl"n‘»’m R mnnn;t,sfl:c.umys Reliable 0LD BY DRUGGISTS EVERYWHERF Dry Wood Jack Pine $4.00 per cord. Cut in 16 inch lengths $1.75 Birch $6.00 per cord. Cut in 16 inch lengths $2. 25 Delivered in clty 'St. Hilairs Retall Lbr, Go. *NorthW'eSt‘ News st office at Bemidji, |'—— har- |- FROST, THEN BECORD HEAT IN 60 HOURS Grand Forks, N..D. Eegt. 2.—Within sixty hours the température here climbed from frost to the highest of the summer season. i recorded. Sunday morning the tem- perature was 36 degrees. t****i*****i*i*t for New Zealand, livery. Find: Only “Fool’s Gold.” St.. Paul, Minn., Sept. of gold.” sent it. - — Fire at Grand Rapids. Grand Rapids, Minn., Sept. a meat market by Rusch & Eide. No clew has been found to origin of the fire. by James J. Hill, New York city today. fulness for the future. _ A R e S e Pioneer want ads pay. body Likes It, It's Painless and Takes But a Moment to Apply. pestered world. cause ‘millions -have {at ever. if Saw Anything: mfllflnfly‘l‘l{d" M:‘A:a'lly as ‘Ge"-ltl' corn remedy on earth today. will, ‘surcly “get ' that - you've been trying for a . long ¢¥i{iikiili¥i*¥i Tuesday afternoon a tem- * perature of 92 degrees was ' **********t****fi = EHR R KKK KKK KKK is all stored ‘at P! Montreal, so rapid has been the de- f 2.—There will be no gold seekers’ rush: into | Morrison county where -Joseph Shiek | of Plerz last week discovered a ‘“pot Dean W. R. Appleby of the university school of mines went} through the find today and sent it back to C. M. Andrist, secretary to 4] the governor, to whom Mr. Shiek had | “Fool’s gold,’ or mica, is what Dean Appleby heartlessly pro- . | nounced it. 2.— Fire early yesterday morning did $300 damage to the McAlpin building on the corner of Leland avenue and Fouth street, which was occupied as |, the Hill Says Grain Record Broken. St. Paul, Sept. 2.—The grain yield L of Great Northern territory in 1915 is 20,000,000 bushels greater than in 1912, the banner year heretofore, accoirding to an estimate made today says word from Mr. Hill add- ed that though general business is quiet in the northwest, there is an undertone of confidence and cheer- ‘Why’s “Gots-lf," for- v : Corns, Like-aKiss? | Because Everybody Tries It, Every- “Gets-It” 1s the wonder of the cor: l]llons say 80, be~ used it. That's what makes it the biggest selling o ] PEAR AR ‘ \ ‘WHEN IN BEMIDJI STOP AT B . . . -I usiness and Professional The Grand Central Hotel e e [ MAYBE YOU'LL FIND IT l.-klEvR"E’ ‘Department These ads. bring certain results. One-half cent a word per issue. cash with copy, i1c a word oth- erwise. Always telephone No. 31 Girlhood-Wo Ay i ~and-Motherhooad * The prescription which Dr. R. Vi “Pierce: used ‘most sucwslf\lfly—-ln dlseuecof ‘women—which has stoddithe test:of-nearly half.a century—is 1 liquid or tablet.form as a tonic-and. regulator! .Wfl. of Beazley.Essex Co,, Va., sas “I esteem it a pleum to v quaites o Favorle Presction. For R DR S 'd“’?l"" N2 xwm:mr'?nym m&‘gd i %‘h" aiter gt vi ihe “Pl!a;anNN.l Dever - e ort wasalwavsslcknndwmplllnlndlndmafla s Yousee what a debt1.owe you!” t Pellets vegulatcmtomaeh,«lwer, bowela /FOR RENT, FOR RENT—ALIl modern rooms, two for light housekeeping, one parlor and bedroom, two bedrooms. Reas- - ‘WANTED-—Setter and:five other saw mill men at once, for-15,000 capa- city mill. Apply Bemidji Employ- ment Co. onable. Close in. Call at Fair WANTED—Competent girl for gen- Store. e eral housework. Call 220 3rd St.|FOR RENT—12-room house, all R < Phone 157. modern, good - location. Inquire Henrionnet Millinery parlors, phone 210. FOR RENT—Furnished room, mod- ern, with sitting room adjoining. 1023 Minnesota Ave. Phone 317-R. FOR 'RENT — 6-room house. All modern. Inquire Henrionnet Millin- ery parlors or Phone 210. FOR RENT—Three houses, one with bath; close in. Smith, 317 Am- erica. FOR RENT—Five rooms upstairs, 918 America Ave. Phone 26-F-11. FOR RENT House, 511 Third St. Inquire Grand Central hotel. FOR RENT—Furnished room with bath. 504 Beltrami Ave. FOR RENT—Two office rooms. Ap- ply W. G. Schroeder. FOR RENT—Modern room. Call 110 6th St. WANTED Ticket seller, Phone 61- o8 W ‘or call at box office, ‘Grand Theater. ‘WANTED—Kitchen girl at the Mark- ham hotel. Apply at once. WANTED—Painter. Call 110 Sixth * street or Phone 231. —— FOR SALE. FOR SALE—At new wood yard, wood all lengths. delivered at your door. . Leave all orders at Ander- son’s Employment Office, 206 Min- nesota Ave. Phone 147. Lizzie Miller, Prop. i FOR SALE—Several .good.- residence lots on Minnesota, Bemidji .and Dewey avenues. Reasonable prices; easy terms. Clayton C. .Cross. Of- fice over Northern Nat’l Bank. FOR SALE OR TRADE—Ford tour- ing car, 1914 model. Will consider 6]1«: i)um{ 6 Quaht You can’t afford to eat or drink anything which you are not ab- = solutely sure is PURE. Every drop of our milk comes from a HEALTHY COW, fed on bal- anced ratiqn, milked in abso- farm ' land. Berman Insurance FARMS FOR SALE. lutely sanitary guarters and P o b b R al |y ey o i then the milk is clarafied. FOR SALE—Gasoline launch, also Soat 600 cmd: wood, half h"' } .. The Wholesomeness and Pur- i fxespassenger: car;scheap if;taken ;‘a:: on good stream, one mile from ! ity of our Milk is Unsurpassed. at; once..;Phone 129-W. —| = town, terms Hberal, price $20.00 *011;1?:-11:' ;:)sw dfx}:)filingou a bottle " WANTED. per acre. W. G. Schroeder. ¥ ? WANTED TO BUY—We pay - cash MISCELLANEOUS You will readily taste the ° difference. e Phone us your order now, to- day, while you think of it. ‘W. G. Schroeder Phone 65 or 66 Bemidji, Minn, - for cast off suits and shoes. Zieg- ler’s Second Hand Store. WANTED—Second hand = househkold goods. M. E. Ibertson. FOR 'SALE—Typewriter ribbons for every make of typewriter on the market at 50 cents and 76 cents each. Hvery ribbon sold for 75 cents guaranteed. Phone orders promptly filled. -Mail orders given the same careful attention as when you appear in person. Phone 31. The Bemidji Pioneer Office Supply Store. i FOR SALE—Rubber stamps. The { Pioneer will procure any kind of rubber stamp for you on short no- i tice. l Pioneer want ads bring results. A-girl’s face usually lights up when she is offered a match.--Omaha World- Herald. e e e You carr get a big, fat pencil tab- let for a nickle at the Pioneer office, and an extra big, fat ink paper com- position book for a dime. All the “kids” will want one when they see MINNESOTA AVENUE European Plan Strictly odern Rooms 50c up & Meals 25c up ‘WM. J. DUGAS, Prop., Bemidji, Minn. DR. ROWLAND GILMORE PHYSICIAN AND SURGEON Office—Miles Block DR. E. A, SHANNON, M. D. PHYSICIAN AND SUI'LGEON Office in Maye Block GRAHAM M. TORRANCE, LAWYER Miles - Block Phone '560 D. H. FISK, Court Commissioner ATTORNEY AT LAW Office second floor O’Leary-Bowser “Gets-Tt" cors or callus time take it right ofl “clean ply it in 2 seconds, —put your stockl ng and shoe right over it,—nothing to stick, nothing to hurt. You needn’t fuss with thick bandages that make a package out of your toe. No knives, razors and scis- -80r8; noitape, no_trouble. It’s simplicity itself, sure, quick, painless. Try it also; for buniong and war! rts, -It” s sold at all druggists, “Gets: 3 8 i S 25c a bottle, or sent direct “Lawrence & Co., Chicago. Sold in Bemidji and recommendéed: as the world’s best corn remedy|by Barker’s Drug Store. G-INGH. SLABWOOD :FOR -SALE Softwood $2.00 per load 7 Phone 481 -Hardwood $2.50 per:load . —-ATTEND— BemidjiBusiness Gnllegfl Day and Night |- layton C.. Iflkl m Hofel: Bllldlng {Phone 100 Bemidji en fal o FHIRD ST. Building. Phone 396 Res. Phone 397 : DR. C. R. SANBORN . VETERINARY SURGEON PHYSICIAN AND SURGEON sl L o i . W. K. DENISON, D. V. M, % Office—Miles Block The Real Thirst VETERINARIAN DR TS Phone 3 DR. G:HOEY GRADUATE VETERINARIAN Call Pogue’s ‘Livery—164 DRAY LINE AN AN AT TOM SMART 'DRAY AND TRANSFER Safe and Piano-Movi 403 Irvine Ave. | "PHYSICIAN AND SURGEON Over First National Bank Bemidji, Minn. DR. E. H. SMITH PHYSICIAN AND SURGEON Office Security Bank Block DR. EINER JOHNSON PHYSICIAN AND- SURGEON Quencher that is, dt the same time, 50 sweet- ly appetizing and highly invigor- ating, is undoubtedly our:splendid. - g Ice Cream Soda, made of the purest and - freshest “Fruit - Juices. W, use only the soundest and freshest, ripe fruit and the best of soda. and every ingredient entering into escprongios S18iamerien-dve, = Rl Moan any of our drinks is guaranteed to - Office: Phone 12. A.V. GARngg,c KL];ST DR. D. L.:STANTON, {EYE EAR NOSE THROAT DENTIST Glasses Fitted Office in Winter -Block Office Gibbons Bldg. North ot Markham Hotel: Phone 105. DR. J. T.-TUOMY, -DENTIST Gibbons Block Tel. 230 North of, Markham Hotel HILMA M. NYGREN GRADUATE NURSE Phone 317-R ‘CANDY COMPANY BEMIDJI KRR KR KRR R KKXKD * -RAILROAD TIME CARD§ ¢ EEK KKK R KKK KKS The Pioneer is the place to buy 2 your rolls of adding machine paper for Burroughs adding machines. One roll, a dozen rolls or a hundred rolls. e e e 335 3 Pealers - NEW AND SECOND HAND CARBON PAPER SISERASE Tage &% 5 SEEEEENE B "Cook Stoves, Ranges, Wood Heaters, - Any Color : Combination Coal and Wood Heaters, ' ? msl’;l;ec;!s!;og” Self Feeding ‘Hard Coal Stoves. Anythmg you want in a stove All_makes and all sizes. ‘ Stov ’ l?epairs A uspecialty BEMIDJI PIONEER PUB. CO. . - BEMIDJI, MINK. NEW PUBLIC LIBRARY. Open daily, except Bunaay, 1 to 6 p. m, 7 to 9 p. m: Sunday, reading room 23 only 8 to 6 p. m. .Huffman & 0'Leary FURNITURE AND UNDERTAKING H [N. McKEE “Funeral Director ; fimne_n'n _DIRECTOR ¥. E. IBERTSON < UNDERTAKER